PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn301081
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family NAC
Protein Properties Length: 315aa    MW: 35850 Da    PI: 8.9621
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn301081genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM42.22.4e-13811205291
         NAM  52 kaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                  ++e+ew+fFs+r +ky++g++++rat+sgyWkatgk+++
  Achn301081  81 VQSESEWFFFSSRGRKYPNGSQSKRATESGYWKATGKERK 120
                 45678********************************886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100511.56629191IPR003441NAC domain
PfamPF023654.0E-579138IPR003441NAC domain
SuperFamilySSF1019413.79E-1281120IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 315 aa     Download sequence    Send to blast
MFSYDLKRIG VTRDWIKIQV FTVRTNLLLL LDLRRHSSIT RGVEESSILT SSSSKRCSIK  60
RKNTSFQSAS SAFRADAKSV VQSESEWFFF SSRGRKYPNG SQSKRATESG YWKATGKERK  120
DSMVICRLRK NAEFRLNDSP RQGSSSRRHE NTSNLASEDN SHNSHSVEHQ LGTGSDSDQR  180
ERDEFCQISS SHQGCDDEDC YADILKDDIV DLGQSLLPPT PSEKSEDERK SQDPVEAIPL  240
RALPFQGTAE RRIRLRKLKT EKYYAGLLDV DIFNKNPTEK SGIDFDRLVK GLEYHLQSEW  300
LFYLGGCVAT LQRK*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1250256RRIRLRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009340876.11e-48PREDICTED: NAC domain-containing protein 89-like
TrEMBLA5BXG92e-45A5BXG9_VITVI; Putative uncharacterized protein
TrEMBLF6HHD12e-45F6HHD1_VITVI; Putative uncharacterized protein
STRINGVIT_06s0080g00970.t016e-45(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA41542243
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G22290.18e-29NAC domain containing protein 89